PITRM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81728] - Staining of human cerebral cortex, colon, heart muscle and testis using Anti-PITRM1 antibody NBP1-81728 (A) shows similar protein distribution across tissues to independent antibody NBP1-81729 (B).

Western Blot: PITRM1 Antibody [NBP1-81728] - Analysis using Anti-PITRM1 antibody NBP1-81728 (A) shows similar pattern to independent antibody NBP1-81729 (B).

Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81728] - Staining of human heart muscle.

Western Blot: PITRM1 Antibody [NBP1-81728] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81728] - Staining of human colon.

Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81728] - Staining of human testis.

Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81728] - Staining of human cerebral cortex.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PITRM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITRM1 Antibody - BSA Free (NBP1-81728) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQNRLLPDHTYSVVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITRM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PITRM1 Protein (NBP1-81728PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PITRM1 Antibody - BSA Free

• EC 3.4.24
• EC 3.4.24.-
• hPreP
• Metalloprotease 1
• MGC138192
• MGC141929
• pitrilysin metallopeptidase 1
• Pitrilysin metalloproteinase 1mitochondrial
• PreP

Background

ATP-independent protease that degrades mitochondrial transit peptides after their cleavage. Also degrades other unstructured peptides. Specific for peptides in the range of 10 to 65 residues. Able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease. Shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITRM1