PITPNC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PITPNC1 Antibody [NBP2-58685] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PITPNC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITPNC1 Antibody - BSA Free (NBP2-58685) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTI
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PITPNC1 Recombinant Protein Antigen (NBP2-58685PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PITPNC1 Antibody - BSA Free

• cytoplasmic phosphatidylinositol transfer protein 1
• Mammalian rdgB homolog beta
• M-rdgB beta
• MrdgBbeta
• phosphatidylinositol transfer protein, cytoplasmic 1
• RDGBB
• RDGBB1
• rdgBbeta
• RDGB-BETA
• retinal degeneration B beta 1
• Retinal degeneration B homolog beta

Background

PITPNC1, also known as Cytoplasmic phosphatidylinositol transfer protein 1, has a 332 amino acid long isoform that is 38 kDa and a short 268 amino acid isoform that is 32 kDa, with cytoplasmatic subcellular location, ubiquitously expressed, mediates the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity, able to transfer phosphatidylinositol in vitro. This protein is currently being studied for research on retinal degeneration and retinitis. Interactions with the PITPNC1 protein have been shown to involve AGTRAP and UBC in transport and signal transduction processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNC1