PITPN Antibody (4G10)

Images

 
Western Blot: PITPN Antibody (4G10) [H00005306-M01] - PITPNA monoclonal antibody (M01), clone 4G10. Analysis of PITPNA expression in NIH/3T3.
Western Blot: PITPN Antibody (4G10) [H00005306-M01] - PITPNA monoclonal antibody (M01), clone 4G10. Analysis of PITPNA expression in PC-12.
Western Blot: PITPN Antibody (4G10) [H00005306-M01] - PITPNA monoclonal antibody (M01), clone 4G10. Analysis of PITPNA expression in HepG2.
Western Blot: PITPN Antibody (4G10) [H00005306-M01] - PITPNA monoclonal antibody (M01), clone 4G10. Analysis of PITPNA expression in Raw 264.7.
Sandwich ELISA: PITPN Antibody (4G10) [H00005306-M01] - Detection limit for recombinant GST tagged PITPNA is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PITPN Antibody (4G10) Summary

Immunogen
PITPNA (NP_006215.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Specificity
PITPNA - phosphatidylinositol transfer protein, alpha (4G10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PITPNA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PITPN Antibody (4G10)

  • MGC99649
  • phosphatidylinositol transfer protein alpha isoform
  • phosphatidylinositol transfer protein, alpha
  • PI-TPalpha
  • PI-TP-alpha
  • PITPNphosphotidylinositol transfer protein
  • PtdIns transfer protein alpha
  • PtdInsTP alpha
  • VIB1A

Background

Phosphatidylinositol transfer protein is a member of a diverse set of cytosolic phospholipid transfer proteins that are distinguished by their ability to transfer phospholipids between membranes in vitro (Wirtz, 1991 [PubMed 1883207]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005957-M37
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-12266
Species: Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1538
Species: Ha, Hu, Rt
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45729
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DY1177-05
Species: Hu
Applications: ELISA
NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP2-46422
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-87382
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-97834
Species: Hu
Applications: IHC, IHC-P, WB
H00058488-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-84969
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00000817-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB

Publications for PITPN Antibody (H00005306-M01) (0)

There are no publications for PITPN Antibody (H00005306-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITPN Antibody (H00005306-M01) (0)

There are no reviews for PITPN Antibody (H00005306-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITPN Antibody (H00005306-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PITPN Products

Array H00005306-M01

Bioinformatics Tool for PITPN Antibody (H00005306-M01)

Discover related pathways, diseases and genes to PITPN Antibody (H00005306-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITPN Antibody (H00005306-M01)

Discover more about diseases related to PITPN Antibody (H00005306-M01).
 

Pathways for PITPN Antibody (H00005306-M01)

View related products by pathway.

Research Areas for PITPN Antibody (H00005306-M01)

Find related products by research area.

Blogs on PITPN

There are no specific blogs for PITPN, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PITPN Antibody (4G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PITPNA
Entrez
Uniprot