PIP5K2B Antibody - BSA Free

Western Blot: PIP5K2B Antibody [NBP2-56946] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: PIP5K2B Antibody [NBP2-56946] - Staining of human cell line RH-30 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIP5K2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PIP5K2B Antibody - BSA Free (NBP2-56946) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIP4K2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIP5K2B Antibody - BSA Free

• 1-phosphatidylinositol-4-phosphate kinase
• 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta
• Diphosphoinositide kinase 2-beta
• EC 2.7.1
• EC 2.7.1.149
• phosphatidylinositol-4-phosphate 5-kinase, type II, beta
• Phosphatidylinositol-5-phosphate 4-kinase type II beta
• phosphatidylinositol-5-phosphate 4-kinase type-2 beta
• phosphatidylinositol-5-phosphate 4-kinase, type II, beta
• PI(5)P 4-kinase type II beta
• PI5P4KB
• PIP4KII-beta
• PIP5K2B
• PIP5KIIB
• PIP5KIIbeta
• PTDINS(4)P-5-kinase
• PtdIns(5)P-4-kinase isoform 2-beta

Background

PIP5K2B, also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 beta, has a 416 amino acid long isoform that is approximately 47 kDa and a short 281 amino acid isoform that is approximately 32 kDa. PIP5K2B interacts with p55 TNF receptor and is implicated in the biosynthesis of PIP2, which is a phospholipid component of the plasma membrane. Current research on PIP5K2B is being conducted in relation to several diseases and disorders including breast cancer and ataxia. Research has shown that PIP5K2B has interactions with BTK, RAC1, RNPS1, UBQLN4 and TNF Receptor I in pathways such as calcium signaling, cAMP signaling, regulation of actin cytoskeleton, and Inositol phosphate metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIP4K2B