PIK3R5 Antibody

Images

 
Western Blot: PIK3R5 Antibody [NBP2-57055] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PIK3R5 Antibody [NBP2-57055] - Staining of human cell line U-2 OS shows localization to cytosol & microtubule organizing center.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIK3R5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP
Specificity
Specificity of human PIK3R5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3R5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIK3R5 Recombinant Protein Antigen (NBP2-57055PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PIK3R5 Antibody

  • F730038I15Rik
  • FOAP-2
  • p101
  • p101-PI3K
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit
  • phosphoinositide-3-kinase, regulatory subunit 5
  • phosphoinositide-3-kinase, regulatory subunit, polypeptide p101
  • PI3-kinase p101 subunit
  • PI3-kinase regulatory subunit 5
  • PIK3R5
  • PtdIns-3-kinase regulatory subunit
  • regulatory subunit 5, p101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67488
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34136
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67504
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55197
Species: Hu
Applications: ICC/IF
NB100-65530
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIK3R5 Antibody (NBP2-57055) (0)

There are no publications for PIK3R5 Antibody (NBP2-57055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R5 Antibody (NBP2-57055) (0)

There are no reviews for PIK3R5 Antibody (NBP2-57055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIK3R5 Antibody (NBP2-57055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PIK3R5 Products

Bioinformatics Tool for PIK3R5 Antibody (NBP2-57055)

Discover related pathways, diseases and genes to PIK3R5 Antibody (NBP2-57055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3R5 Antibody (NBP2-57055)

Discover more about diseases related to PIK3R5 Antibody (NBP2-57055).
 

Pathways for PIK3R5 Antibody (NBP2-57055)

View related products by pathway.

Blogs on PIK3R5

There are no specific blogs for PIK3R5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIK3R5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R5