PIK3R6 Antibody

Images

 
Immunohistochemistry-Paraffin: PIK3R6 Antibody [NBP2-48560] - Staining of human placenta shows distinct cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIK3R6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PAAPVTDHTCLNVNVTEVVKSSNLAGKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKP
Specificity
Specificity of human PIK3R6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3R6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIK3R6 Antibody

  • C17orf38
  • chromosome 17 open reading frame 38
  • FLJ34500
  • HsT41028
  • p84
  • p87 phosphoinositide 3-kinase gamma (PI3Kg) adapter protein
  • p87 PI3K adapter protein
  • p87(PIKAP)
  • p87PIKAPDKFZp666P158
  • Phosphoinositide 3-kinase gamma adapter protein of 87 kDa
  • phosphoinositide 3-kinase regulatory subunit 6
  • phosphoinositide-3-kinase, regulatory subunit 6
  • PI3Kgamma adapter protein of 87 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65530
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-46411
Species: Hu
Applications: WB, IHC
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31106
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
NBP2-46413
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67168
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32691
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-48560
Species: Hu
Applications: IHC, IHC-P

Publications for PIK3R6 Antibody (NBP2-48560) (0)

There are no publications for PIK3R6 Antibody (NBP2-48560).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R6 Antibody (NBP2-48560) (0)

There are no reviews for PIK3R6 Antibody (NBP2-48560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIK3R6 Antibody (NBP2-48560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PIK3R6 Products

Bioinformatics Tool for PIK3R6 Antibody (NBP2-48560)

Discover related pathways, diseases and genes to PIK3R6 Antibody (NBP2-48560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for PIK3R6 Antibody (NBP2-48560)

Find related products by research area.

Blogs on PIK3R6

There are no specific blogs for PIK3R6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIK3R6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R6
Novus 100% Guarantee