PIK3R4 Antibody (2A6)

Images

 
Western Blot: PIK3R4 Antibody (2A6) [H00030849-M05] - Analysis of PIK3R4 expression in PC-12 (Cat # L012V1).

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
2A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIK3R4 Antibody (2A6) Summary

Immunogen
PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Specificity
PIK3R4 - phosphoinositide-3-kinase, regulatory subunit 4, p150 (2A6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIK3R4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIK3R4 Antibody (2A6)

  • EC 2.7.11.1
  • MGC102700
  • p150
  • phosphatidylinositol 3-kinase-associated p150
  • Phosphoinositide 3-kinase adaptor protein
  • phosphoinositide 3-kinase regulatory subunit 4
  • phosphoinositide-3-kinase, regulatory subunit 4
  • phosphoinositide-3-kinase, regulatory subunit 4, p150
  • PI3-kinase p150 subunit
  • PI3-kinase regulatory subunit 4
  • PIK3R4
  • VPS 15
  • VPS15

Background

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF1008
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB110-97871
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
796-IC
Species: Mu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB110-87320
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, KD, Simple Western, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
210-TA
Species: Hu
Applications: BA
NBP2-43567
Species: Hu, Mu
Applications: ICC/IF, KO, WB
NBP1-88829
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88840
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
H00030849-M05
Species: Hu, Rt
Applications: WB, ELISA

Publications for PIK3R4 Antibody (H00030849-M05) (0)

There are no publications for PIK3R4 Antibody (H00030849-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R4 Antibody (H00030849-M05) (0)

There are no reviews for PIK3R4 Antibody (H00030849-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIK3R4 Antibody (H00030849-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIK3R4 Products

Array H00030849-M05

Bioinformatics Tool for PIK3R4 Antibody (H00030849-M05)

Discover related pathways, diseases and genes to PIK3R4 Antibody (H00030849-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3R4 Antibody (H00030849-M05)

Discover more about diseases related to PIK3R4 Antibody (H00030849-M05).
 

Pathways for PIK3R4 Antibody (H00030849-M05)

View related products by pathway.

PTMs for PIK3R4 Antibody (H00030849-M05)

Learn more about PTMs related to PIK3R4 Antibody (H00030849-M05).
 

Research Areas for PIK3R4 Antibody (H00030849-M05)

Find related products by research area.

Blogs on PIK3R4

There are no specific blogs for PIK3R4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIK3R4 Antibody (2A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R4
Entrez
Uniprot