Recombinant Human PIK3CA Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PIK3CA Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 959-1068 of Human PIK3CA

Source: Wheat Germ

Amino Acid Sequence: DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIK3CA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 3
using
H00005290-Q01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIK3CA Protein

  • EC 2.7.1
  • EC 2.7.1.153
  • MGC142161
  • MGC142163
  • p110-alpha
  • Phosphatidylinositol 3-Kinase catalytic subunit alpha
  • phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha
  • phosphatidylinositol 3-kinase, catalytic, alpha polypeptide
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, alpha isoform
  • phosphoinositide-3-kinase, catalytic, alpha polypeptide
  • PI3K
  • PI3K-alpha
  • PI3-kinase p110 subunit alpha
  • PI3-kinase subunit alpha
  • PtdIns-3-kinase p110
  • PtdIns-3-kinase subunit alpha
  • PtdIns-3-kinase subunit p110-alpha

Background

PIK3CA - phosphoinositide-3-kinase, catalytic, alpha polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB847
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO

Publications for PIK3CA Partial Recombinant Protein (H00005290-Q01) (0)

There are no publications for PIK3CA Partial Recombinant Protein (H00005290-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PIK3CA Partial Recombinant Protein (H00005290-Q01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005290-Q01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PIK3CA H00005290-Q01
Enlarge
reviewed by:
Andrew Cosgrove
WB Human 11/07/2013
View

Summary

ApplicationWestern Blot
Sample Testedhuman ovarian cell lysate
SpeciesHuman

Primary Anitbody

Dilution Ratio1:1000 in BSA

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIK3CA Partial Recombinant Protein (H00005290-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PIK3CA Products

Bioinformatics Tool for PIK3CA Partial Recombinant Protein (H00005290-Q01)

Discover related pathways, diseases and genes to PIK3CA Partial Recombinant Protein (H00005290-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3CA Partial Recombinant Protein (H00005290-Q01)

Discover more about diseases related to PIK3CA Partial Recombinant Protein (H00005290-Q01).
 

Pathways for PIK3CA Partial Recombinant Protein (H00005290-Q01)

View related products by pathway.

PTMs for PIK3CA Partial Recombinant Protein (H00005290-Q01)

Learn more about PTMs related to PIK3CA Partial Recombinant Protein (H00005290-Q01).
 

Research Areas for PIK3CA Partial Recombinant Protein (H00005290-Q01)

Find related products by research area.

Blogs on PIK3CA

There are no specific blogs for PIK3CA, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Andrew Cosgrove
11/07/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol PIK3CA