PIK3C2A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PIK3C2A Antibody [NBP1-80909] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PIK3C2A Antibody [NBP1-80909] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIK3C2A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PIK3C2A Antibody - BSA Free (NBP1-80909) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIK3C2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PIK3C2A Protein (NBP1-80909PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIK3C2A Antibody - BSA Free

• C2-containing phosphatidylinositol kinase
• CPK
• DKFZp686L193
• EC 2.7.1
• EC 2.7.1.137
• EC 2.7.1.153
• EC 2.7.1.154
• MGC142218
• phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha
• Phosphoinositide 3-kinase-C2-alpha
• phosphoinositide-3-kinase, class 2, alpha polypeptide
• PI3-K-C2(ALPHA)
• PI3-K-C2A
• PI3K-C2alpha
• PI3K-C2-alpha
• PIK3C2A
• PtdIns-3-kinase C2 subunit alpha

Background

PIK3C2A belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3C2A
• Entrez:
  • 5286(Human)
• Uniprot:
  • O00443(Human)