PIGU Antibody - BSA Free

Western Blot: PIGU Antibody [NBP1-98429] - Titration: 1.0 ug/ml Positive Control: Mouse Kidney.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIGU Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Pigu - N-terminal region. Peptide sequence PLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLALLDL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIGU Antibody - BSA Free

• bA346K17.2
• CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1
• CDC91L1CDC91 cell division cycle 91-like 1 (S. cerevisiae)
• cell division cycle 91-like 1 protein
• Cell division cycle protein 91-like 1
• GAB1
• GPI transamidase component PIG-U
• GPI transamidase subunit
• MGC40420
• phosphatidylinositol glycan anchor biosynthesis class U protein
• phosphatidylinositol glycan anchor biosynthesis, class U
• Protein CDC91-like 1

Background

CDC91L1 - CDC91 cell division cycle 91-like 1 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGU
• Uniprot:
  • NP_001004721(Mouse)