PIGT Antibody - BSA Free

Western Blot: PIGT Antibody [NBP2-82311] - Host: Rabbit. Target Name: PIGT. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIGT Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIGT. Peptide sequence: ITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIGT Antibody - BSA Free

• FLJ41596
• GPI transamidase component PIG-T
• GPI transamidase subunit
• MGC8909
• NDAP
• neurotrophin-regulated neuronal development-associated protein
• phosphatidyl inositol glycan class T
• phosphatidylinositol glycan anchor biosynthesis, class T
• phosphatidylinositol glycan, class T
• Phosphatidylinositol-glycan biosynthesis class T protein

Background

PIGT encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGT