pIgR Antibody

Images

 
Immunohistochemistry: pIgR Antibody [NBP1-86504] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

pIgR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
pIgR Protein (NBP1-86504PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for pIgR Antibody

  • FLJ22667
  • hepatocellular carcinoma associated protein TB6
  • Hepatocellular carcinoma-associated protein TB6
  • MGC125361
  • MGC125362
  • pIgR
  • Poly-Ig receptor
  • polymeric immunoglobulin receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-89128
Species: Hu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for pIgR Antibody (NBP1-86504) (0)

There are no publications for pIgR Antibody (NBP1-86504).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for pIgR Antibody (NBP1-86504) (0)

There are no reviews for pIgR Antibody (NBP1-86504). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for pIgR Antibody (NBP1-86504) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional pIgR Products

Bioinformatics Tool for pIgR Antibody (NBP1-86504)

Discover related pathways, diseases and genes to pIgR Antibody (NBP1-86504). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for pIgR Antibody (NBP1-86504)

Discover more about diseases related to pIgR Antibody (NBP1-86504).
 

Pathways for pIgR Antibody (NBP1-86504)

View related products by pathway.

PTMs for pIgR Antibody (NBP1-86504)

Learn more about PTMs related to pIgR Antibody (NBP1-86504).

Blogs on pIgR

There are no specific blogs for pIgR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our pIgR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGR
Entrez
Uniprot