PIGP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PIGP Antibody [NBP1-84294] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: PIGP Antibody [NBP1-84294] - Staining of human stomach shows strong membranous positivity in parietal cells.

Analysis in control (vector only transfected HEK293T lysate) and PIGP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407008).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIGP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PIGP Protein (NBP1-84294PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIGP Antibody - BSA Free

• class P
• DCRCDown syndrome critical region protein C
• Down syndrome critical region protein 5
• DSCR5DCRC-S
• DSCRC
• DSRC
• EC 2.4.1.198
• phosphatidylinositol glycan anchor biosynthesis, class P
• Phosphatidylinositol-glycan biosynthesis class P protein
• phosphatidylinositol-n-acetylglucosaminyltranferase subunit
• PIG-P

Background

The PIGP gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a compone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIGP Antibody (NBP1-84294)(1)

Publication using NBP1-84294

• Uhlen M, Oksvold P, Algenas C et al. Antibody-based Protein Profiling of the Human Chromosome 21. Mol Cell Proteomics 2012-03-01 [PMID: 22042635]

Bioinformatics

• Gene Symbol: PIGP