PIGC Antibody

Images

 
Western Blot: PIGC Antibody [NBP1-86283] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunohistochemistry: PIGC Antibody [NBP1-86283] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YLIRLQLFKENIHGPWDEAEIKEDLSRFLS
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGC Protein (NBP1-86283PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGC Antibody

  • EC 2.4.1.198
  • GPI2class C protein
  • MGC2049
  • phosphatidylinositol glycan anchor biosynthesis, class C
  • phosphatidylinositol glycan, class C

Background

PIGC, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit C, is 297 amino acids in length and approximately 34 kDa. PIGC is an important player in GPI anchor biosynthesis because it catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol. Current research on PIGC is being performed relating to several diseases and disorders including malaria and lassa fever. PIGC has also been shown to have interactions with PIGA, DPM2, KLF10, PIGQ and ZHX1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIGC Antibody (NBP1-86283) (0)

There are no publications for PIGC Antibody (NBP1-86283).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGC Antibody (NBP1-86283) (0)

There are no reviews for PIGC Antibody (NBP1-86283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGC Antibody (NBP1-86283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGC