PIGC Antibody

Images

 
Western Blot: PIGC Antibody [NBP1-86283] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunohistochemistry: PIGC Antibody [NBP1-86283] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YLIRLQLFKENIHGPWDEAEIKEDLSRFLS
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGC Protein (NBP1-86283PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGC Antibody

  • EC 2.4.1.198
  • GPI2class C protein
  • MGC2049
  • phosphatidylinositol glycan anchor biosynthesis, class C
  • phosphatidylinositol glycan, class C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13760
Species: Hu
Applications: IHC, IHC-P
H00009091-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83342
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84294
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38056
Species: Hu
Applications: IHC, IHC-P
NBP1-05034
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-31564
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
NBP2-94070
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-86283
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PIGC Antibody (NBP1-86283) (0)

There are no publications for PIGC Antibody (NBP1-86283).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGC Antibody (NBP1-86283) (0)

There are no reviews for PIGC Antibody (NBP1-86283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGC Antibody (NBP1-86283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGC Products

Bioinformatics Tool for PIGC Antibody (NBP1-86283)

Discover related pathways, diseases and genes to PIGC Antibody (NBP1-86283). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGC Antibody (NBP1-86283)

Discover more about diseases related to PIGC Antibody (NBP1-86283).
 

Pathways for PIGC Antibody (NBP1-86283)

View related products by pathway.

PTMs for PIGC Antibody (NBP1-86283)

Learn more about PTMs related to PIGC Antibody (NBP1-86283).

Blogs on PIGC

There are no specific blogs for PIGC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGC