PIGL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PIGL Antibody [NBP1-86471] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PIGL Antibody [NBP1-86471] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIGL Protein (NBP1-86471PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGL Antibody

  • EC 3.5.1.89
  • N-acetylglucosaminylphosphatidylinositol deacetylase
  • N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
  • phosphatidylinositol glycan anchor biosynthesis, class L
  • phosphatidylinositol glycan, class L
  • Phosphatidylinositol-glycan biosynthesis class L protein
  • PIG-L

Background

PIGL, also referred to as N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, is approximately 29 kDa and 252 amino acids in length. PIGL localizes to the endoplasmic reticulum and is an important player the synthesis of GPI anchors as it catalyzes the second step in the reaction. Current research on PIGL is being performed relating to several diseases and disorders including congenital heart disease, babesiosis, ear anomalies syndrome, ichthyosiform dermatosis, malaria and sleeping sickness. PIGL has also been shown to have interactions with PIGA, PIGC, PIGH, DPM2, and GPLD1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIGL Antibody (NBP1-86471) (0)

There are no publications for PIGL Antibody (NBP1-86471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGL Antibody (NBP1-86471) (0)

There are no reviews for PIGL Antibody (NBP1-86471). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PIGL Antibody (NBP1-86471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGL