PIGF Antibody

Images

 
Western Blot: PIGF Antibody [NBP1-69261] - This Anti-PIGF antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: PIGF Antibody [NBP1-69261] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGF Antibody Summary

Immunogen
Synthetic peptides corresponding to PIGF(phosphatidylinositol glycan anchor biosynthesis, class F) The peptide sequence was selected from the N terminal of PIGF. Peptide sequence MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PIGF and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIGF Antibody

  • GPI11 homolog
  • MGC32646
  • MGC33136
  • phosphatidylinositol glycan anchor biosynthesis, class F
  • phosphatidylinositol glycan, class F
  • phosphatidylinositol-glycan biosynthesis class F protein
  • PIG-F

Background

PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-69261
Species: Hu
Applications: WB, IHC

Publications for PIGF Antibody (NBP1-69261) (0)

There are no publications for PIGF Antibody (NBP1-69261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGF Antibody (NBP1-69261) (0)

There are no reviews for PIGF Antibody (NBP1-69261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGF Antibody (NBP1-69261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGF Products

Bioinformatics Tool for PIGF Antibody (NBP1-69261)

Discover related pathways, diseases and genes to PIGF Antibody (NBP1-69261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGF Antibody (NBP1-69261)

Discover more about diseases related to PIGF Antibody (NBP1-69261).
 

Pathways for PIGF Antibody (NBP1-69261)

View related products by pathway.

PTMs for PIGF Antibody (NBP1-69261)

Learn more about PTMs related to PIGF Antibody (NBP1-69261).

Blogs on PIGF

There are no specific blogs for PIGF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGF
Uniprot