PI 3-Kinase p85 beta Antibody (6E2F5)

Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493] - Western blot analysis of extracts of various cell lines, using PI 3-Kinase p85 beta antibody (NBP3-16493) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 6E2F5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PI 3-Kinase p85 beta Antibody (6E2F5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PIK3R2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PI 3-Kinase p85 beta Antibody (6E2F5)

• P85B
• p85-beta
• phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta
• phosphatidylinositol 3-kinase regulatory subunit beta
• phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta)
• phosphoinositide-3-kinase, regulatory subunit 2 (beta)
• phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta)
• phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta)
• PI 3Kinase p85 beta
• PI 3-Kinase p85 beta
• PI3K regulatory subunit beta
• PI3-kinase regulatory subunit beta
• PI3-kinase subunit p85-beta
• PIK3R2
• ptdIns-3-kinase regulatory subunit beta
• ptdIns-3-kinase regulatory subunit p85-beta

Background

The enzyme phosphatidylinositol 3 kinase (PI3 kinase) is a lipid kinase that generates phosphatidylinositol 3, 4, 5-triphosphate in response to receptor activation in many signal transduction pathways. Class IA PI3Ks exist as a heterodimer of a catalytic 110 kDa (p110) and a regulatory p85 subunit (e.g. p85 beta). p85 beta is an adaptor molecule that regulates the activity of the catalytic p110 subunit by binding to phosphorylated receptor tyrosine kinases (RTKs) through its SH2 domain and mediating the interaction between p110 and the plasma membrane. p85 beta is necessary for insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3R2