PI 3-Kinase p85 alpha Antibody

Images

 
Western Blot: PI 3-Kinase p85 alpha Antibody [NBP1-89731] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: PI 3-Kinase p85 alpha Antibody [NBP1-89731] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PI 3-Kinase p85 alpha Antibody [NBP1-89731] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PI 3-Kinase p85 alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PI 3-Kinase p85 alpha Protein (NBP1-89731PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PI 3-Kinase p85 alpha Antibody

  • GRB1
  • GRB1PI3-kinase subunit p85-alpha
  • p85
  • p85-ALPHA
  • Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
  • phosphatidylinositol 3-kinase regulatory subunit alpha
  • phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha)
  • phosphatidylinositol 3-kinase, regulatory, 1
  • phosphatidylinositol 3-kinase-associated p-85 alpha
  • phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
  • PI 3Kinase p85 alpha
  • PI 3-Kinase p85 alpha
  • PI3K regulatory subunit alpha
  • PI3-kinase regulatory subunit alpha
  • PIK3R1
  • PtdIns-3-kinase regulatory subunit alpha
  • PtdIns-3-kinase regulatory subunit p85-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6347
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PI 3-Kinase p85 alpha Antibody (NBP1-89731) (0)

There are no publications for PI 3-Kinase p85 alpha Antibody (NBP1-89731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p85 alpha Antibody (NBP1-89731) (0)

There are no reviews for PI 3-Kinase p85 alpha Antibody (NBP1-89731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PI 3-Kinase p85 alpha Antibody (NBP1-89731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PI 3-Kinase p85 alpha Products

Bioinformatics Tool for PI 3-Kinase p85 alpha Antibody (NBP1-89731)

Discover related pathways, diseases and genes to PI 3-Kinase p85 alpha Antibody (NBP1-89731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p85 alpha Antibody (NBP1-89731)

Discover more about diseases related to PI 3-Kinase p85 alpha Antibody (NBP1-89731).
 

Pathways for PI 3-Kinase p85 alpha Antibody (NBP1-89731)

View related products by pathway.

PTMs for PI 3-Kinase p85 alpha Antibody (NBP1-89731)

Learn more about PTMs related to PI 3-Kinase p85 alpha Antibody (NBP1-89731).
 

Research Areas for PI 3-Kinase p85 alpha Antibody (NBP1-89731)

Find related products by research area.

Blogs on PI 3-Kinase p85 alpha

There are no specific blogs for PI 3-Kinase p85 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p85 alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R1
Entrez