PI 3-Kinase p55 gamma Recombinant Protein Antigen

Images

 
There are currently no images for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PI 3-Kinase p55 gamma Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIK3R3.

Source: E. coli

Amino Acid Sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIK3R3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57974.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PI 3-Kinase p55 gamma Recombinant Protein Antigen

  • DKFZp686P05226
  • FLJ41892
  • p55
  • p55-GAMMA
  • p55PIK
  • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  • phosphatidylinositol 3-kinase regulatory subunit gamma
  • phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 3 (p55, gamma)
  • phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
  • PI 3Kinase p55 gamma
  • PI 3-Kinase p55 gamma
  • PI3K regulatory subunit gamma
  • PI3-kinase regulatory subunit gamma
  • PI3-kinase subunit p55-gamma
  • PIK3R3
  • PtdIns-3-kinase regulatory subunit gamma
  • ptdIns-3-kinase regulatory subunit p55-gamma
  • regulatory subunit, polypeptide 3 (p55, gamma)

Background

PI 3-Kinase p55 gamma, also referred to as PI3Kp55 gamma or p55gamma, is a regulatory subunit of phosphatidylinositol 3-kinase (PI 3-Kinase / PI3K) (1). Class 1A PI 3-Kinases are heterodimers consisting of one 110 kDa catalytic subunit (p110 alpha, beta, or delta) and one regulatory subunit (p85 alpha, p85 beta, p55 alpha, p50 alpha, or p55 gamma) (1). The p55 gamma regulatory subunit is encoded by the PIK3R3 gene and is predominantly expressed in the brain (2). Human PI 3 Kinase p55 gamma protein is 461 amino acids (aa) in length with a theoretical molecular weight of ~54 kDa (3). Structurally, PI 3-Kinase p55 gamma contains a proline rich domain (aa 34 - 44) and two Src homology domains (SH2, aa 65 - 160 and 358 - 452) (1,3). In general, Class 1A PI 3-Kinases are activated through the binding of membrane-bound tyrosine kinase receptors, such as insulin-like growth factor 1 (IGF-1) (1,2,4). Activation of PI 3-Kinase results in the phosphorylation of phosphatidyl inositol and a downstream signaling cascade of the AKT/mTOR pathway (2,4). PI 3-Kinase pathway activation results in a number of cellular responses including proliferation, survival, growth, migration, membrane trafficking, and metabolism (2). The PI3-Kinase/AKT/mTOR pathway has been shown to be dysregulated in a number of cancers, largely through loss or inactivation of the tumor suppressor PTEN (4). Furthermore, one study found that anaplastic lymphoma kinase (ALK) promoted cell migration during brain development specifically through the p55 gamma regulatory subunit of PI 3-Kinase (5).

References

1. Backer J. M. (2010). The regulation of class IA PI 3-kinases by inter-subunit interactions. Current Topics in Microbiology and Immunology. https://doi.org/10.1007/82_2010_52

2. Hirsch, E., Costa, C., & Ciraolo, E. (2007). Phosphoinositide 3-kinases as a common platform for multi-hormone signaling. The Journal of Endocrinology. https://doi.org/10.1677/JOE-07-0097

3. Uniprot (Q92569)

4. Yang, J., Nie, J., Ma, X., Wei, Y., Peng, Y., & Wei, X. (2019). Targeting PI3K in cancer: mechanisms and advances in clinical trials. Molecular Cancer. https://doi.org/10.1186/s12943-019-0954-x

5. Seo, M., Kim, J. H., & Suk, K. (2017). Role of the p55-gamma subunit of PI3K in ALK-induced cell migration: RNAi-based selection of cell migration regulators. Cell Adhesion & Migration. https://doi.org/10.1080/19336918.2016.1202385

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
DRT200
Species: Hu
Applications: ELISA
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
201-LB
Species: Hu
Applications: BA
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-57974PEP
Species: Hu
Applications: AC

Publications for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP) (0)

There are no publications for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP) (0)

There are no reviews for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PI 3-Kinase p55 gamma Products

Research Areas for PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP)

Find related products by research area.

Blogs on PI 3-Kinase p55 gamma

There are no specific blogs for PI 3-Kinase p55 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PI 3-Kinase p55 gamma Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R3