Recombinant Human PI 3-Kinase p55 gamma Protein

Images

 
SDS-Page: Recombinant Human PIK3R3 Protein [H00008503-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human PI 3-Kinase p55 gamma Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 271-380 of Human PIK3R3

Source: Wheat Germ

Amino Acid Sequence: HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIK3R3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PI 3-Kinase p55 gamma Protein

  • 100% homology to SWISS-PROT Q92569
  • DKFZp686P05226
  • FLJ41892
  • p55
  • p55PIK
  • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  • phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
  • phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma)
  • phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma)
  • PI 3Kinase p55 gamma
  • PI 3-Kinase p55 gamma
  • PI3K regulatory subunit gamma
  • PI3-kinase subunit p55-gamma
  • PIK3R3
  • regulatory subunit, polypeptide 3 (p55, gamma)

Background

PIK3R3 - phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-75525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
7270-IL/CF
Species: Hu
6507-IL/CF
Species: Hu
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01) (0)

There are no publications for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01) (0)

There are no reviews for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PI 3-Kinase p55 gamma Products

Bioinformatics Tool for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01)

Discover related pathways, diseases and genes to PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01)

Discover more about diseases related to PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01).
 

Pathways for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01)

View related products by pathway.

PTMs for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01)

Learn more about PTMs related to PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01).
 

Research Areas for PI 3-Kinase p55 gamma Partial Recombinant Protein (H00008503-Q01)

Find related products by research area.

Blogs on PI 3-Kinase p55 gamma

There are no specific blogs for PI 3-Kinase p55 gamma, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PI 3-Kinase p55 gamma Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R3
COVID-19 update