Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Human 721_B, Antibody Dilution: 1.0 ug/ml PLSCR1 is supported by BioGPS gene expression data to be expressed in 721_B.

Immunohistochemistry: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Nucleus Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Human 293T, Antibody Dilution: 1.0 ug/ml PLSCR1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLSCR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

• Erythrocyte phospholipid scramblase
• MMTRA1B
• MMTRA1BCa(2+)-dependent phospholipid scramblase 1
• Phospholipid Scramblase 1
• PL scramblase 1
• PLSCR1

Background

PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLSCR1
• Uniprot:
  • O15162()