PLSCR3 Antibody


Western Blot: PLSCR3 Antibody [NBP1-52866] - Analysis of PLSCR3 in mouse lung tissues using PLSCR3 antibody. Tissues were untreated or treated with 100 ng/ml LPS. Image from verified customer review.
Western Blot: PLSCR3 Antibody [NBP1-52866] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

PLSCR3 Antibody Summary

Synthetic peptides corresponding to PLSCR3(phospholipid scramblase 3) The peptide sequence was selected from the middle region of PLSCR3. Peptide sequence GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PLSCR3 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
NBP1-52866 in the following application:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLSCR3 Antibody

  • Ca(2+)-dependent phospholipid scramblase 3
  • phospholipid scramblase 3
  • PL scramblase 3


PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PLSCR3 Antibody (NBP1-52866) (0)

There are no publications for PLSCR3 Antibody (NBP1-52866).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PLSCR3 Antibody (NBP1-52866) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-52866:
Filter by Applications
Western Blot
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot PLSCR3 NBP1-52866
reviewed by:
Liyong Zhang
Western Blot Mouse 08/06/2016


ApplicationWestern Blot
LotPO number: E0524899

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLSCR3 Antibody (NBP1-52866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLSCR3 Products

Bioinformatics Tool for PLSCR3 Antibody (NBP1-52866)

Discover related pathways, diseases and genes to PLSCR3 Antibody (NBP1-52866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLSCR3 Antibody (NBP1-52866)

Discover more about diseases related to PLSCR3 Antibody (NBP1-52866).

Pathways for PLSCR3 Antibody (NBP1-52866)

View related products by pathway.

PTMs for PLSCR3 Antibody (NBP1-52866)

Learn more about PTMs related to PLSCR3 Antibody (NBP1-52866).

Blogs on PLSCR3

There are no specific blogs for PLSCR3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Liyong Zhang
Application: Western Blot
Species: Mouse


Gene Symbol PLSCR3