PLSCR3 Antibody

Images

 
Western Blot: PLSCR3 Antibody [NBP1-52866] - Analysis of PLSCR3 in mouse lung tissues using PLSCR3 antibody. Tissues were untreated or treated with 100 ng/ml LPS. Image from verified customer review.
Western Blot: PLSCR3 Antibody [NBP1-52866] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLSCR3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PLSCR3(phospholipid scramblase 3) The peptide sequence was selected from the middle region of PLSCR3. Peptide sequence GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLSCR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PLSCR3 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-52866 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLSCR3 Antibody

  • Ca(2+)-dependent phospholipid scramblase 3
  • phospholipid scramblase 3
  • PL scramblase 3

Background

PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32380
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB8137
Species: Hu
Applications: WB, ICC
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-89301
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-06661
Species: Hu
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLSCR3 Antibody (NBP1-52866) (0)

There are no publications for PLSCR3 Antibody (NBP1-52866).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PLSCR3 Antibody (NBP1-52866) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-52866:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PLSCR3 NBP1-52866
Enlarge
reviewed by:
Anonymous
WB Mouse 08/06/2016
View

Summary

ApplicationWestern Blot
SpeciesMouse
LotPO number: E0524899
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLSCR3 Antibody (NBP1-52866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLSCR3 Products

Bioinformatics Tool for PLSCR3 Antibody (NBP1-52866)

Discover related pathways, diseases and genes to PLSCR3 Antibody (NBP1-52866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLSCR3 Antibody (NBP1-52866)

Discover more about diseases related to PLSCR3 Antibody (NBP1-52866).
 

Pathways for PLSCR3 Antibody (NBP1-52866)

View related products by pathway.

PTMs for PLSCR3 Antibody (NBP1-52866)

Learn more about PTMs related to PLSCR3 Antibody (NBP1-52866).

Blogs on PLSCR3

There are no specific blogs for PLSCR3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/06/2016
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol PLSCR3
Uniprot
COVID-19 update