PLSCR4 Antibody

Images

 
Western Blot: PLSCR4 Antibody [NBP1-86165] - Analysis in human fallopian tube tissue.
Immunocytochemistry/ Immunofluorescence: PLSCR4 Antibody [NBP1-86165] - Staining of human cell line SiHa shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: PLSCR4 Antibody [NBP1-86165] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil and subset of glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLSCR4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLSCR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLSCR4 Protein (NBP1-86165PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLSCR4 Antibody

  • Ca(2+)-dependent phospholipid scramblase 4
  • cell growth inhibiting protein 43
  • Cell growth-inhibiting gene 43 protein
  • phospholipid scramblase 4
  • PL scramblase 4
  • TRA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-90243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79724
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
NBP2-86955
Species: Hu
Applications: WB
NBP1-89238
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-52866
Species: Hu, Mu
Applications: WB
NBP3-16183
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13853
Species: Hu
Applications: Flow, IP, PA, WB
NBP2-45466
Species: Hu, Mu, Rt
Applications: IHC, PAGE, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for PLSCR4 Antibody (NBP1-86165) (0)

There are no publications for PLSCR4 Antibody (NBP1-86165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLSCR4 Antibody (NBP1-86165) (0)

There are no reviews for PLSCR4 Antibody (NBP1-86165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLSCR4 Antibody (NBP1-86165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLSCR4 Products

Bioinformatics Tool for PLSCR4 Antibody (NBP1-86165)

Discover related pathways, diseases and genes to PLSCR4 Antibody (NBP1-86165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLSCR4 Antibody (NBP1-86165)

Discover more about diseases related to PLSCR4 Antibody (NBP1-86165).
 

Pathways for PLSCR4 Antibody (NBP1-86165)

View related products by pathway.

Research Areas for PLSCR4 Antibody (NBP1-86165)

Find related products by research area.

Blogs on PLSCR4

There are no specific blogs for PLSCR4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLSCR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLSCR4