Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Western blot analysis of extracts of HT-29 cells, using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb (NBP3-16183) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Western blot analysis of extracts of Mouse lung, using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb (NBP3-16183) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Immunohistochemistry of paraffin-embedded human breast cancer using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb (NBP3-16183) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) [NBP3-16183] - Immunofluorescence analysis of C6 cells using Phospholipid Phospholipid Scramblase 1/PLSCR1 (PLSCR1) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 5U6G1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) Summary

• Description: Novus Biologicals Rabbit Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1) (NBP3-16183) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1/PLSCR1 (NP_066928.1). MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PLSCR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Phospholipid Scramblase 1/PLSCR1 Antibody (5U6G1)

• Erythrocyte phospholipid scramblase
• MMTRA1B
• MMTRA1BCa(2+)-dependent phospholipid scramblase 1
• Phospholipid Scramblase 1
• PL scramblase 1
• PLSCR1

Background

Scramblase 1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in theplasma membrane. May play a central role in the initiation of fibrin clot forma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLSCR1