PHKG2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PHKG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PHKG2 Antibody - BSA Free
Background
PHKG2, also known as Phosphorylase b kinase gamma catalytic chain, liver/testis isoform, has 2 isoforms, a 406 amino acid long isoform that is 46 kDa and a short 374 amino acid isoform that is 43 kDa, as catalytic subunit of the phosphorylase b kinase (PHK) mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase and may regulate glycogeneolysis in the testis and phosphorylates PYGM in vitro. Studies on this protein have shown a relationship with the following diseases and disorders: glycogen storage disease, cirrhosis due to liver, phosphorylase kinase deficiency, hepatitis, metabolic disorders, hypotonia malaria, and alcoholism. This protein has interactions with PHKG1, UBE3A, PHKA2, PHKB, and PYGL in PKA signaling, cAMP Pathway, activation of cAMP-dependent PKA, alpha-adrenergic signaling, metabolism of carbohydrates, glycogen breakdown (glycogenolysis), glucose metabolism, calcium signaling pathway and insulin signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ICC/IF
Publications for PHKG2 Antibody (NBP2-55815) (0)
There are no publications for PHKG2 Antibody (NBP2-55815).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHKG2 Antibody (NBP2-55815) (0)
There are no reviews for PHKG2 Antibody (NBP2-55815).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PHKG2 Antibody (NBP2-55815) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PHKG2 Products
Research Areas for PHKG2 Antibody (NBP2-55815)
Find related products by research area.
|
Blogs on PHKG2