PHKG2 Antibody

Images

 
Independent Antibodies: Western Blot: PHKG2 Antibody [NBP2-55815] - Analysis using Anti-PHKG2 antibody NBP2-55815 (A) shows similar pattern to independent antibody NBP2-56609 (B).
Immunocytochemistry/ Immunofluorescence: PHKG2 Antibody [NBP2-55815] - Staining of human cell line MCF7 shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PHKG2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
Specificity
Specificity of human PHKG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHKG2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PHKG2 Knockout 293T Cell Lysate
Control Peptide
PHKG2 Recombinant Protein Antigen (NBP2-55815PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PHKG2 Antibody

  • EC 2.7.11
  • EC 2.7.11.19
  • GSD9C
  • PHK-gamma-T
  • phosphorylase b kinase gamma catalytic chain, testis/liver isoform
  • Phosphorylase kinase subunit gamma-2
  • phosphorylase kinase, gamma 2 (testis)
  • Phosphorylase kinase, gamma 2 (testis/liver)
  • PSK-C3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92264
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00030008-B01P
Species: Hu
Applications: WB, Flow
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
640-A3
Species: Mu
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NBP2-88128
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54724
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PHKG2 Antibody (NBP2-55815) (0)

There are no publications for PHKG2 Antibody (NBP2-55815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKG2 Antibody (NBP2-55815) (0)

There are no reviews for PHKG2 Antibody (NBP2-55815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHKG2 Antibody (NBP2-55815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PHKG2 Products

Bioinformatics Tool for PHKG2 Antibody (NBP2-55815)

Discover related pathways, diseases and genes to PHKG2 Antibody (NBP2-55815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHKG2 Antibody (NBP2-55815)

Discover more about diseases related to PHKG2 Antibody (NBP2-55815).
 

Pathways for PHKG2 Antibody (NBP2-55815)

View related products by pathway.

Research Areas for PHKG2 Antibody (NBP2-55815)

Find related products by research area.

Blogs on PHKG2

There are no specific blogs for PHKG2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHKG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKG2