PHIP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PHIP Antibody [NBP2-33883] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHIP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PHIP Antibody - BSA Free (NBP2-33883) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PHIP Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHIP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PHIP Recombinant Protein Antigen (NBP2-33883PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHIP Antibody - BSA Free

• DCAF14
• DDB1 and CUL4 associated factor 14
• FLJ20705
• FLJ45918
• IRS-1 PH domain-binding protein
• MGC90216
• ndrp
• PH-interacting protein
• pleckstrin homology domain interacting protein
• WD repeat-containing protein 11
• WDR11

Background

PH-interacting protein (PHIP) was isolated as factor that binds to the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS-1). PHIP was determined not to be a substrate of the insulin receptor but may instead serve to link IRS-1 to the insulin receptor. PHIP has also been implicated as a positive regulator of beta-cell mitogenesis and survival. PHIP is also known as WD-repeat-containing protein 11, WDR11, and IRS-1 PH domain-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHIP Antibody (NBP2-33883)(3)

Publications using NBP2-33883

• Tirado-Class N, Hathaway C, Nelligan A et al. DCAF14 regulates CDT2 to promote SET8-dependent replication fork protection Life science alliance 2024-01-01 [PMID: 37940188] (WB)
• Tirado-Class N, Hathaway C, Chung WK, Dungrawala H PHIP variants associated with Chung-Jansen syndrome disrupt replication fork stability and genome integrity Cold Spring Harbor molecular case studies 2022-07-21 [PMID: 35863899]
• Townsend A, Lora G, Engel J, et al. DCAF14 promotes stalled fork stability to maintain genome integrity Cell reports 2021-01-26 [PMID: 33503431]

Bioinformatics

• Gene Symbol: PHIP
• Uniprot:
  • Q8WWQ0(Human)