PHF21A Antibody


Western Blot: PHF21A Antibody [NBP2-88046] - Host: Rabbit. Target Name: PHF21A. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: PHF21A Antibody [NBP2-88046] - WB Suggested Anti-PHF21A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HT1080 cell lysatePHF21A is supported by BioGPS gene expression data to be more
Western Blot: PHF21A Antibody [NBP2-88046] - Host: Rabbit. Target Name: PHF21A. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: PHF21A Antibody [NBP2-88046] - Host: Rabbit. Target Name: PHF21A. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

PHF21A Antibody Summary

The immunogen is a synthetic peptide directed towards the N terminal region of human PHF21A. Peptide sequence: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for PHF21A Antibody

  • BHC80a
  • BHC80BM-006
  • BRAF35-HDAC complex protein BHC80
  • KIAA1696BRAF35/HDAC2 complex (80 kDa)
  • PHD finger protein 21A


PHF21A - PHD finger protein 21A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHF21A Antibody (NBP2-88046) (0)

There are no publications for PHF21A Antibody (NBP2-88046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF21A Antibody (NBP2-88046) (0)

There are no reviews for PHF21A Antibody (NBP2-88046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF21A Antibody (NBP2-88046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PHF21A Products

Research Areas for PHF21A Antibody (NBP2-88046)

Find related products by research area.

Blogs on PHF21A

There are no specific blogs for PHF21A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PHF21A Antibody and receive a gift card or discount.


Gene Symbol PHF21A