PHF21A Antibody

Images

 
Western Blot: PHF21A Antibody [NBP2-88046] - Host: Rabbit. Target Name: PHF21A. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: PHF21A Antibody [NBP2-88046] - WB Suggested Anti-PHF21A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HT1080 cell lysatePHF21A is supported by BioGPS gene expression data to be ...read more
Western Blot: PHF21A Antibody [NBP2-88046] - Host: Rabbit. Target Name: PHF21A. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: PHF21A Antibody [NBP2-88046] - Host: Rabbit. Target Name: PHF21A. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF21A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PHF21A. Peptide sequence: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PHF21A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF21A Antibody

  • BHC80a
  • BHC80BM-006
  • BRAF35-HDAC complex protein BHC80
  • KIAA1696BRAF35/HDAC2 complex (80 kDa)
  • PHD finger protein 21A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1762
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, Simple Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP3-16225
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00010362-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NB100-41418
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00006328-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-86288
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P

Publications for PHF21A Antibody (NBP2-88046) (0)

There are no publications for PHF21A Antibody (NBP2-88046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF21A Antibody (NBP2-88046) (0)

There are no reviews for PHF21A Antibody (NBP2-88046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF21A Antibody (NBP2-88046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF21A Products

Bioinformatics Tool for PHF21A Antibody (NBP2-88046)

Discover related pathways, diseases and genes to PHF21A Antibody (NBP2-88046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF21A Antibody (NBP2-88046)

Discover more about diseases related to PHF21A Antibody (NBP2-88046).
 

Pathways for PHF21A Antibody (NBP2-88046)

View related products by pathway.

PTMs for PHF21A Antibody (NBP2-88046)

Learn more about PTMs related to PHF21A Antibody (NBP2-88046).
 

Research Areas for PHF21A Antibody (NBP2-88046)

Find related products by research area.

Blogs on PHF21A

There are no specific blogs for PHF21A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF21A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF21A