PHAX Antibody


Immunocytochemistry/ Immunofluorescence: PHAX Antibody [NBP2-48821] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining in human cerebral cortex and pancreas tissues using anti-PHAX antibody. Corresponding PHAX RNA-seq data are presented for the same tissues.
Immunohistochemistry: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PHAX Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
Specificity of human PHAX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHAX Recombinant Protein Antigen (NBP2-48821PEP)

Reactivity Notes

Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PHAX Antibody

  • FLJ13193
  • phosphorylated adapter RNA export protein
  • phosphorylated adaptor for RNA export
  • RNA U small nuclear RNA export adapter protein
  • RNA U, small nuclear RNA export adapter (phosphorylation regulated)
  • RNA U, small nuclear RNA export adaptor (phosphorylation regulated)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PHAX Antibody (NBP2-48821) (0)

There are no publications for PHAX Antibody (NBP2-48821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHAX Antibody (NBP2-48821) (0)

There are no reviews for PHAX Antibody (NBP2-48821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PHAX Antibody (NBP2-48821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PHAX Antibody (NBP2-48821)

Discover related pathways, diseases and genes to PHAX Antibody (NBP2-48821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHAX Antibody (NBP2-48821)

Discover more about diseases related to PHAX Antibody (NBP2-48821).

Pathways for PHAX Antibody (NBP2-48821)

View related products by pathway.

PTMs for PHAX Antibody (NBP2-48821)

Learn more about PTMs related to PHAX Antibody (NBP2-48821).

Blogs on PHAX

There are no specific blogs for PHAX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PHAX Antibody and receive a gift card or discount.


Gene Symbol PHAX