PHAX Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PHAX Antibody [NBP2-48821] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining in human cerebral cortex and pancreas tissues using anti-PHAX antibody. Corresponding PHAX RNA-seq data are presented for the same tissues.
Immunohistochemistry: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHAX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
Specificity
Specificity of human PHAX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHAX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHAX Recombinant Protein Antigen (NBP2-48821PEP)

Reactivity Notes

Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHAX Antibody

  • FLJ13193
  • phosphorylated adapter RNA export protein
  • phosphorylated adaptor for RNA export
  • RNA U small nuclear RNA export adapter protein
  • RNA U, small nuclear RNA export adapter (phosphorylation regulated)
  • RNA U, small nuclear RNA export adaptor (phosphorylation regulated)
  • RNUXA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-31101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22457
Species: Rt
Applications: WB
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PHAX Antibody (NBP2-48821) (0)

There are no publications for PHAX Antibody (NBP2-48821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHAX Antibody (NBP2-48821) (0)

There are no reviews for PHAX Antibody (NBP2-48821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PHAX Antibody (NBP2-48821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PHAX Antibody (NBP2-48821)

Discover related pathways, diseases and genes to PHAX Antibody (NBP2-48821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHAX Antibody (NBP2-48821)

Discover more about diseases related to PHAX Antibody (NBP2-48821).
 

Pathways for PHAX Antibody (NBP2-48821)

View related products by pathway.

PTMs for PHAX Antibody (NBP2-48821)

Learn more about PTMs related to PHAX Antibody (NBP2-48821).

Blogs on PHAX

There are no specific blogs for PHAX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHAX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHAX