PHAX Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PHAX Antibody [NBP2-48821] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining in human cerebral cortex and pancreas tissues using anti-PHAX antibody. Corresponding PHAX RNA-seq data are presented for the same tissues.

Immunohistochemistry: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.

Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHAX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PHAX Antibody - BSA Free (NBP2-48821) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHAX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PHAX Recombinant Protein Antigen (NBP2-48821PEP)

Reactivity Notes

Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHAX Antibody - BSA Free

• FLJ13193
• phosphorylated adapter RNA export protein
• phosphorylated adaptor for RNA export
• RNA U small nuclear RNA export adapter protein
• RNA U, small nuclear RNA export adapter (phosphorylation regulated)
• RNA U, small nuclear RNA export adaptor (phosphorylation regulated)
• RNUXA

Background

A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner . Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHAX