PGRMC1 Antibody - BSA Free

Western Blot: PGRMC1 Antibody [NBP1-59827] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-59827] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PGRMC1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PGRMC1(progesterone receptor membrane component 1) The peptide sequence was selected from the N terminal of PGRMC1. Peptide sequence MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PGRMC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PGRMC1 Antibody - BSA Free

• HPR6.6
• HPR6.6PGRMC
• membrane-associated progesterone receptor component 1
• MPR
• PGRMC1
• Progesterone Binding Protein
• progesterone receptor membrane component 1

Background

Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PGRMC1
• Uniprot:
  • O00264(Human)