PGR1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PGR1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGR1.
  
  

  Source: E. coli

  Amino Acid Sequence: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PTGR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87892.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PGR1 Recombinant Protein Antigen

• 15-oxoprostaglandin 13-reductase
• EC 1.3.1.-
• EC 1.3.1.48
• EC 1.3.1.74
• FLJ99229
• leukotriene B4 12-hydroxydehydrogenase
• LTB4DH
• MGC34943
• NADP-dependent leukotriene B4 12-hydroxydehydrogenase
• PGR1
• PRG-1
• prostaglandin reductase 1
• ZADH3
• zinc binding alcohol dehydrogenase domain containing 3

Background

PGR1, or Prostaglandin reductase 1, contains a 36 kDa and a 33 kDa isoform, and is involved in the conversion of leukotriene B4 to 12-oxo-leukotriene B4. Current disease research is being conducted to determine the relationship between PGR1 and alcoholism and lung cancer. The protein is linked to the synthesis of lipoxins, leukotrienes, eoxins, protaglandins, and thromboxanes, and arachidonic acid metabolism. Through these processes, PGR1 interacts with UBC, FNBP1L, HAT1, RBBP4, and HSP90AA1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PTGR1