New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

PGGT1B Antibody

Images

 
Western Blot: PGGT1B Antibody [NBP2-85467] - Host: Rabbit. Target Name: Pggt1b. Sample Type: Rat Small Intestine lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGGT1B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PGGT1B. Peptide sequence: HAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKTKDSKQCS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PGGT1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGGT1B Antibody

  • BGGI
  • EC 2.5.1
  • EC 2.5.1.59
  • Geranylgeranyl transferase type I subunit beta
  • geranylgeranyl transferase type-1 subunit beta
  • geranylgeranyltransferase type I beta subunit
  • GGTase-I-beta
  • GGTI
  • protein geranylgeranyltransferase type I, beta subunit
  • Type I protein geranyl-geranyltransferase subunit beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83368
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
AF1555
Species: Hu
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP2-74359
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-85445
Species: Hu
Applications: IHC, IHC-P, WB
MAB7557
Species: Hu
Applications: IHC, WB
NBP2-85467
Species: Rt
Applications: WB

Publications for PGGT1B Antibody (NBP2-85467) (0)

There are no publications for PGGT1B Antibody (NBP2-85467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGGT1B Antibody (NBP2-85467) (0)

There are no reviews for PGGT1B Antibody (NBP2-85467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGGT1B Antibody (NBP2-85467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGGT1B Products

Bioinformatics Tool for PGGT1B Antibody (NBP2-85467)

Discover related pathways, diseases and genes to PGGT1B Antibody (NBP2-85467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGGT1B Antibody (NBP2-85467)

Discover more about diseases related to PGGT1B Antibody (NBP2-85467).
 

Pathways for PGGT1B Antibody (NBP2-85467)

View related products by pathway.

Blogs on PGGT1B

There are no specific blogs for PGGT1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGGT1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGGT1B