We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PGD2 Synthase/PTGDS Recombinant Protein Antigen

Images

 
There are currently no images for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PGD2 Synthase/PTGDS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGDS.

Source: E. coli

Amino Acid Sequence: SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTGDS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81291.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PGD2 Synthase/PTGDS Recombinant Protein Antigen

  • Beta-trace protein
  • Cerebrin-28
  • EC 5.3.99.2
  • Glutathione-independent PGD synthase
  • glutathione-independent PGD synthetase
  • lipocalin-type prostaglandin D synthase
  • Lipocalin-type prostaglandin-D synthase
  • L-PGDS
  • PDS
  • PGD2 Synthase
  • PGD2
  • PGDS2
  • PGDSLPGDS
  • PH2DISO
  • prostaglandin D synthase
  • prostaglandin D2 synthase (21kD, brain)
  • prostaglandin D2 synthase 21kDa (brain)
  • Prostaglandin-D2 synthase
  • prostaglandin-H2 D-isomerase
  • PTGDS

Background

Prostaglandin D Synthase (PTGDS), is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of amyloid-b plaques in Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-31589
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-60106
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF,  IHC-P
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-32842
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP1-76755
Species: Gp, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-81291PEP
Species: Hu
Applications: AC

Publications for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP) (0)

There are no publications for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP) (0)

There are no reviews for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGD2 Synthase/PTGDS Products

Research Areas for PGD2 Synthase/PTGDS Protein (NBP1-81291PEP)

Find related products by research area.

Blogs on PGD2 Synthase/PTGDS

There are no specific blogs for PGD2 Synthase/PTGDS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PGD2 Synthase/PTGDS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGDS