PEX7 Antibody

Images

 
Immunohistochemistry-Paraffin: PEX7 Antibody [NBP2-13752] Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI LDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PEX7 Protein (NBP2-13752PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX7 Antibody

  • peroxin-7
  • peroxisomal biogenesis factor 7
  • peroxisomal targeting signal 2 receptor
  • peroxisome targeting signal 2 receptor
  • PTS2 receptor
  • PTS2Rperoxisomal PTS2 receptor
  • RCDP1
  • RD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu

Publications for PEX7 Antibody (NBP2-13752) (0)

There are no publications for PEX7 Antibody (NBP2-13752).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX7 Antibody (NBP2-13752) (0)

There are no reviews for PEX7 Antibody (NBP2-13752). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PEX7 Antibody (NBP2-13752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX7 Products

Bioinformatics Tool for PEX7 Antibody (NBP2-13752)

Discover related pathways, diseases and genes to PEX7 Antibody (NBP2-13752). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX7 Antibody (NBP2-13752)

Discover more about diseases related to PEX7 Antibody (NBP2-13752).
 

Pathways for PEX7 Antibody (NBP2-13752)

View related products by pathway.

PTMs for PEX7 Antibody (NBP2-13752)

Learn more about PTMs related to PEX7 Antibody (NBP2-13752).

Blogs on PEX7

There are no specific blogs for PEX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX7