PEX3 Recombinant Protein Antigen

Images

 
There are currently no images for PEX3 Protein (NBP2-38838PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PEX3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX3.

Source: E.coli

Amino Acid Sequence: SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38838.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PEX3 Recombinant Protein Antigen

  • DKFZp686N14184
  • FLJ13531
  • peroxin-3
  • Peroxisomal assembly protein PEX3
  • peroxisomal biogenesis factor 3
  • transformation-related protein 18
  • TRG18

Background

The product of the PEX3 gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: IHC, IHC-P, WB
8090-ZN
Species: Hu
Applications: EnzAct
NBP1-57578
Species: Hu
Applications: WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00008800-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80955
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49599
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-86321
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-17128
Species: Hu
Applications: IHC, IHC-P
NBP1-88622
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93290
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-77122
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for PEX3 Protein (NBP2-38838PEP) (0)

There are no publications for PEX3 Protein (NBP2-38838PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX3 Protein (NBP2-38838PEP) (0)

There are no reviews for PEX3 Protein (NBP2-38838PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEX3 Protein (NBP2-38838PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX3 Products

Bioinformatics Tool for PEX3 Protein (NBP2-38838PEP)

Discover related pathways, diseases and genes to PEX3 Protein (NBP2-38838PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX3 Protein (NBP2-38838PEP)

Discover more about diseases related to PEX3 Protein (NBP2-38838PEP).
 

Pathways for PEX3 Protein (NBP2-38838PEP)

View related products by pathway.

PTMs for PEX3 Protein (NBP2-38838PEP)

Learn more about PTMs related to PEX3 Protein (NBP2-38838PEP).

Blogs on PEX3

There are no specific blogs for PEX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEX3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX3