Orthogonal Strategies: Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Analysis in human parathyroid gland and liver tissues using NBP1-80930 antibody. Corresponding EIF2AK3 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human Colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
This antibody was developed against Recombinant Protein corresponding to amino acids: NAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGNDE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2AK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reported in scientific publication (PMID: 23103912) Use in WB reported in scientific publication( PMID: 32587659).
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%). Human reactivity reported in scientific literature (PMID: 23103912). Use in Chicken reported in scientific publication (PMID: 32587659).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
The activation of signal transduction pathways by growth factors, hormones and neurotransmitters is mediated through two closely related MAP kinases, p44 and p42, designated extracellular-signal related kinase 1 (ERK 1) and ERK 2, respectively. ERK proteins are regulated by dual phosphorylation at Tyrosine 204 and 187 and Threonine 177 and 160 residues mapping within a characteristic Thr-Glu-Tyr motif. Phosphorylation at both the Threonine 202 and Tyrosine 204 residues of ERK 1 and Threonine 185 and Tyrosine 187 residues of ERK 2 is required for full enzymatic activation. The structural consequences of dual phosphorylation in ERK 2 include active site closure, alignment of key catalytic residues that interact with ATP, and remodeling of the activation loop. In response to activation, MAP kinases phosphorylate downstream components on serine and threonine. Upstream MAP kinase regulators include MAP kinase kinase (MEK), MEK kinase and Raf-1. The ERK family has three additional members: ERK 3, ERK 5 and ERK 6.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for PERK Antibody (NBP1-80930)
Discover related pathways, diseases and genes to PERK Antibody (NBP1-80930). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PERK Antibody (NBP1-80930)
Discover more about diseases related to PERK Antibody (NBP1-80930).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PERK Antibody and receive a gift card or discount.