PERK Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Analysis in human parathyroid gland and liver tissues using NBP1-80930 antibody. Corresponding EIF2AK3 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human Colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, ChSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PERK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGNDE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2AK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reported in scientific publication (PMID: 23103912) Use in WB reported in scientific publication( PMID: 32587659).
Control Peptide
PERK Recombinant Protein Antigen (NBP1-80930PEP)
Publications
Read Publications using
NBP1-80930 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%). Human reactivity reported in scientific literature (PMID: 23103912). Use in Chicken reported in scientific publication (PMID: 32587659).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PERK Antibody

  • DKFZp781H1925
  • EC 2.7.11.1
  • EIF2AK3
  • eukaryotic translation initiation factor 2 alpha kinase 3
  • eukaryotic translation initiation factor 2-alpha kinase 3
  • hsPEK
  • PEK
  • PEKPERKPancreatic eIF2-alpha kinase
  • PERK
  • PRKR-like endoplasmic reticulum kinase
  • WRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-2323
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, WB
NB100-852
Species: Hu, Mu
Applications: PEP-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP2-66865
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB

Publications for PERK Antibody (NBP1-80930)(2)

We have publications tested in 2 confirmed species: Human, Chicken.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Chicken
(1)
All Species

Reviews for PERK Antibody (NBP1-80930) (0)

There are no reviews for PERK Antibody (NBP1-80930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PERK Antibody (NBP1-80930) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PERK Products

Bioinformatics Tool for PERK Antibody (NBP1-80930)

Discover related pathways, diseases and genes to PERK Antibody (NBP1-80930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PERK Antibody (NBP1-80930)

Discover more about diseases related to PERK Antibody (NBP1-80930).
 

Pathways for PERK Antibody (NBP1-80930)

View related products by pathway.

PTMs for PERK Antibody (NBP1-80930)

Learn more about PTMs related to PERK Antibody (NBP1-80930).
 

Research Areas for PERK Antibody (NBP1-80930)

Find related products by research area.

Blogs on PERK.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PERK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2AK3
Entrez
Uniprot