Periplakin Antibody

Images

 
Western Blot: Periplakin Antibody [NBP2-49306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunohistochemistry-Paraffin: Periplakin Antibody [NBP2-49306] - Staining in human esophagus and skeletal muscle tissues using anti-PPL antibody. Corresponding PPL RNA-seq data are presented for the same tissues.
Immunohistochemistry: Periplakin Antibody [NBP2-49306] - Staining of human nasopharynx shows cytoplasamic positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Periplakin Antibody [NBP2-49306] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Periplakin Antibody [NBP2-49306] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Periplakin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL
Specificity
Specificity of human Periplakin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Periplakin Recombinant Protein Antigen (NBP2-49306PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Periplakin Antibody

  • 190 kDa paraneoplastic pemphigus antigen
  • 195 kDa cornified envelope precursor protein
  • KIAA0568
  • MGC134872
  • periplakin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-78984
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
DDX0450P-100
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84567
Species: Hu
Applications: IHC, IHC-P
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, B/N
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NB100-242
Species: Mu
Applications: IP (-), WB, ICC/IF, IP
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
46780002
Species: Hu
Applications: ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-49579
Species: Hu
Applications: IHC, IHC-P
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Periplakin Antibody (NBP2-49306) (0)

There are no publications for Periplakin Antibody (NBP2-49306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Periplakin Antibody (NBP2-49306) (0)

There are no reviews for Periplakin Antibody (NBP2-49306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Periplakin Antibody (NBP2-49306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Periplakin Antibody (NBP2-49306)

Discover related pathways, diseases and genes to Periplakin Antibody (NBP2-49306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Periplakin Antibody (NBP2-49306)

Discover more about diseases related to Periplakin Antibody (NBP2-49306).
 

Pathways for Periplakin Antibody (NBP2-49306)

View related products by pathway.

PTMs for Periplakin Antibody (NBP2-49306)

Learn more about PTMs related to Periplakin Antibody (NBP2-49306).

Blogs on Periplakin

There are no specific blogs for Periplakin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Periplakin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPL