Periplakin Antibody - BSA Free

Immunohistochemistry-Paraffin: Periplakin Antibody [NBP2-49306] - Staining in human esophagus and skeletal muscle tissues using anti-PPL antibody. Corresponding PPL RNA-seq data are presented for the same tissues.

Western Blot: Periplakin Antibody [NBP2-49306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue

Immunohistochemistry-Paraffin: Periplakin Antibody [NBP2-49306] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: Periplakin Antibody [NBP2-49306] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Periplakin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Periplakin Recombinant Protein Antigen (NBP2-49306PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Periplakin Antibody - BSA Free

• 190 kDa paraneoplastic pemphigus antigen
• 195 kDa cornified envelope precursor protein
• KIAA0568
• MGC134872
• periplakin

Background

Peroplakin is a component of the cornified envelope of keratinocytes. It may link the cornified envelope to desmosomes and intermediate filaments and may act as a localization signal in PKB/AKT-mediated signaling. [from: http://www.genecards.org/cgi-bin/carddisp.pl®gene=PPL&search=Periplakin] Endogenous periplakin localizes to different cellular compartments, including plasma membrane, intermediate filament structures, the nucleus and mitochondria. Overexpression of the C-terminal part of periplakin, encompassing the PKB binding region, results in predominant intermediate filament localization and little nuclear staining. Periplakin is expressed in epithelial cells, together with envoplakin, the precursor of the epidermal cornified envelope. Furthermore, periplakin has been shown to be a target antigen in paraneoplastic pemphigus, and in keratinocytes it localizes at desmosomes and the interdesmosomal plasma membrane. [from: http://jcs.biologists.org/cgi/content/full/115/20/3957]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPL