Perilipin-3/TIP47 Antibody - BSA Free

Western Blot: Perilipin-3/TIP47 Antibody [NBP2-49485] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Perilipin-3/TIP47 Antibody [NBP2-49485] - Analysis of human cell line A-431 shows positivity in vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: Perilipin-3/TIP47 Antibody [NBP2-49485] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Perilipin-3/TIP47 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Perilipin-3/TIP47 Antibody - BSA Free (NBP2-49485) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLIN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Perilipin-3/TIP47 Antibody - BSA Free

• Cargo selection protein TIP47
• M6PRBP1
• M6PRBP1MGC2012
• Mannose-6-phosphate receptor-binding protein 1
• perilipin 3,47 kDa MPR-binding protein
• Perilipin3
• Perilipin-3
• Placental protein 17,47 kDa mannose 6-phosphate receptor-binding protein
• PLIN3
• PP17
• PP17MGC11117
• tail-interacting protein, 47 kD
• TIP47
• TIP47mannose-6-phosphate receptor binding protein 1

Background

TIP47 has been described as cargo protein involved in the trafficking of the mannose-6-phosphate receptor between endosomes and the Golgi complex. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. PLIN3 has been localized in milk fat globule membranes of human and bovine origin. It has also been described as a placental protein. Increased amounts of TIP47 are secreted into circulation of cervix carcinoma patients. Therefore, TIP47 is probably significant as an oncodevelopmental marker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLIN3