Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human Peptidylglycine alpha-Amidating Monooxygenase/PAM (NP_620176.1). GRVLGRFRGKGSGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALAPSSS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PAM |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - Azide and BSA Free
Background
PAM encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP3-03010) (0)
There are no publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP3-03010).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP3-03010) (0)
There are no reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP3-03010).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP3-03010) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Peptidylglycine alpha-Amidating Monooxygenase/PAM Products
Research Areas for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP3-03010)
Find related products by research area.
|
Blogs on Peptidylglycine alpha-Amidating Monooxygenase/PAM