Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody [NBP2-34075] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody [NBP2-34075] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPPEANIPIPVKSDMVMMHEHHKETEYKDKIPLLQQPKREEEEVL
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Peptidylglycine alpha-Amidating Monooxygenase/PAM Protein (NBP2-34075PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

• PAL
• PAM
• pancreatic peptidylglycine alpha-amidating monooxygenase
• peptidyl alpha-amidating enzyme
• peptidyl-alpha-hydroxyglycine alpha-amidating lyase
• peptidylamidoglycolate lyase
• peptidylglycine 2-hydroxylase
• peptidyl-glycine alpha-amidating monooxygenase
• peptidylglycine alpha-amidating monooxygenase
• peptidylglycine alpha-hydroxylating monooxygenase
• PHM

Background

PAM encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP2-34075). (Showing 1 - 1 of 1 FAQ).

1. Do you provide samples for testing these in new applications? Many companies, recognizing the benefit to their business of extending applications to new species (as well as the risk taken by research teams to test expensive antibodies in new applications), will provide a small, free sample for this purpose. Please let me know.
   • We unfortunately do not provide free samples, but we do offer our Innovator's Reward Program for untested applications or species. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. Submit an online review detailing your results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice.

Bioinformatics

• Gene Symbol: PAM
• Uniprot:
  • P19021()