Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PAM |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
108 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free
Background
PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: WB
Publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318) (0)
There are no publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318) (0)
There are no reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318). (Showing 1 - 2 of 2 FAQ).
-
I'm looking for a polyclonal antibody for Peptidyl-glycine alpha-amidating monooxygenase (PAM) that works in mouse and for immune-fluorescence experiments. I found the following product on your website: NBP1-62288 but the specificity is towards human and has only been tested for western blot. Could I use this antibody for my studies? If not, would you know/have an other antibody that would suit my needs?
- NBP1-62288 is now sold as catalogue number NBP1-69318. Please accept my apologies for any confusion which may have been caused by this change. As you rightly point out, this rabbit polyclonal antibody has been validated for Western blotting with samples from mouse, but has not yet been tested in immunofluorescence. Should you wish to try this antibody for immunofluorescence I can highly recommend our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply need to go to the antibody’s webpage and complete an online review with an image, detailing the positive or negative results of your study. In return you will receive a discount voucher for 100% of the purchase price of the reviewed product.
-
Do you provide samples for testing these in new applications? Many companies, recognizing the benefit to their business of extending applications to new species (as well as the risk taken by research teams to test expensive antibodies in new applications), will provide a small, free sample for this purpose. Please let me know.
- We unfortunately do not provide free samples, but we do offer our Innovator's Reward Program for untested applications or species. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. Submit an online review detailing your results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice.
Secondary Antibodies
| |
Isotype Controls
|
Additional Peptidylglycine alpha-Amidating Monooxygenase/PAM Products
Research Areas for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318)
Find related products by research area.
|
Blogs on Peptidylglycine alpha-Amidating Monooxygenase/PAM