Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

Images

 
Western Blot: PAM Antibody [NBP1-69318] - This Anti-PAM antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAM
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
108 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free

  • PAL
  • PAM
  • pancreatic peptidylglycine alpha-amidating monooxygenase
  • peptidyl alpha-amidating enzyme
  • peptidyl-alpha-hydroxyglycine alpha-amidating lyase
  • peptidylamidoglycolate lyase
  • peptidylglycine 2-hydroxylase
  • peptidyl-glycine alpha-amidating monooxygenase
  • peptidylglycine alpha-amidating monooxygenase
  • peptidylglycine alpha-hydroxylating monooxygenase
  • PHM

Background

PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-85951
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF3587
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
NBP1-89366
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93872
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-25228
Species: Hu
Applications: ICC/IF
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC,  IHC-P, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-69318
Species: Hu
Applications: WB

Publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318) (0)

There are no publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318) (0)

There are no reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318). (Showing 1 - 2 of 2 FAQ).

  1. I'm looking for a polyclonal antibody for Peptidyl-glycine alpha-amidating monooxygenase (PAM) that works in mouse and for immune-fluorescence experiments. I found the following product on your website: NBP1-62288 but the specificity is towards human and has only been tested for western blot. Could I use this antibody for my studies? If not, would you know/have an other antibody that would suit my needs?
    • NBP1-62288 is now sold as catalogue number NBP1-69318. Please accept my apologies for any confusion which may have been caused by this change. As you rightly point out, this rabbit polyclonal antibody has been validated for Western blotting with samples from mouse, but has not yet been tested in immunofluorescence. Should you wish to try this antibody for immunofluorescence I can highly recommend our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply need to go to the antibody’s webpage and complete an online review with an image, detailing the positive or negative results of your study. In return you will receive a discount voucher for 100% of the purchase price of the reviewed product.
  2. Do you provide samples for testing these in new applications? Many companies, recognizing the benefit to their business of extending applications to new species (as well as the risk taken by research teams to test expensive antibodies in new applications), will provide a small, free sample for this purpose. Please let me know.
    • We unfortunately do not provide free samples, but we do offer our Innovator's Reward Program for untested applications or species. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. Submit an online review detailing your results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice.

Secondary Antibodies

 

Isotype Controls

Additional Peptidylglycine alpha-Amidating Monooxygenase/PAM Products

Research Areas for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318)

Find related products by research area.

Blogs on Peptidylglycine alpha-Amidating Monooxygenase/PAM

There are no specific blogs for Peptidylglycine alpha-Amidating Monooxygenase/PAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PAM
Uniprot