Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Peptidase Inhibitor 16/PI16. Source: E. coli
Amino Acid Sequence: TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PI16 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen
Background
PI16 also known as Peptidase Inhibitor 16, has 2 isoforms, a 463 amino acid long isoform that is 49 kDa and a short 270 amino acid isoform that is 30 kDa; expressed in prostate, testis, ovary and intestine, concentrates in prostate cancer patient's sera; and acts as putative serine protease inhibitor. Disease research is currently being studied with relation to PI16 and prostate adenocarcinoma, adenocarcinoma, prostatitis, and prostate cancer. Little is currently known about PI16 protein interactions with other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, Neut, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: AC
Publications for Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen (NBP2-69019PEP) (0)
There are no publications for Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen (NBP2-69019PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen (NBP2-69019PEP) (0)
There are no reviews for Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen (NBP2-69019PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Peptidase Inhibitor 16/PI16 Recombinant Protein Antigen (NBP2-69019PEP) (0)
Additional Peptidase Inhibitor 16/PI16 Products
Blogs on Peptidase Inhibitor 16/PI16