Peptidase Inhibitor 16/PI16 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PI16 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Protein A purified |
Alternate Names for Peptidase Inhibitor 16/PI16 Antibody
Background
PI16 also known as Peptidase Inhibitor 16, has 2 isoforms, a 463 amino acid long isoform that is 49 kDa and a short 270 amino acid isoform that is 30 kDa; expressed in prostate, testis, ovary and intestine, concentrates in prostate cancer patient's sera; and acts as putative serine protease inhibitor. Disease research is currently being studied with relation to PI16 and prostate adenocarcinoma, adenocarcinoma, prostatitis, and prostate cancer. Little is currently known about PI16 protein interactions with other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, Neut, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: IHC
Publications for Peptidase Inhibitor 16/PI16 Antibody (NBP2-69019) (0)
There are no publications for Peptidase Inhibitor 16/PI16 Antibody (NBP2-69019).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Peptidase Inhibitor 16/PI16 Antibody (NBP2-69019) (0)
There are no reviews for Peptidase Inhibitor 16/PI16 Antibody (NBP2-69019).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Peptidase Inhibitor 16/PI16 Antibody (NBP2-69019) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Peptidase Inhibitor 16/PI16 Products
Blogs on Peptidase Inhibitor 16/PI16