PEO1 Antibody (1C5) - Azide and BSA Free

Western Blot: PEO1 Antibody (1C5) [H00056652-M03] - Detection against Immunogen (36.08 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1C5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PEO1 Antibody (1C5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PEO1 Antibody (1C5) - Azide and BSA Free (H00056652-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PEO1 (NP_068602.2, 591 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK
• Specificity: PEO1 - progressive external ophthalmoplegia 1 (1C5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TWNK
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PEO1 Antibody (1C5) - Azide and BSA Free

• ATXN8
• chromosome 10 open reading frame 2
• EC 3.6.4.12
• FLJ21832
• infantile onset spinocerebellar ataxia (autosomal recessive)
• IOSCA
• mitochondrial
• MTDPS7
• PEO1PEOA3
• TWINKLE

Background

Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars (Spelbrink et al., 2001 [PubMed 11431692]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TWNK
• Entrez:
  • 56652(Human)
• Uniprot:
  • NP_068602(Human)