PELO Antibody - Azide and BSA Free

Western Blot: PELO Antibody [H00053918-B01P] - Analysis of PELO expression in human stomach.

Immunocytochemistry/Immunofluorescence: PELO Antibody [H00053918-B01P] - Analysis of purified antibody to PELO on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: PELO Antibody [H00053918-B01P] - Analysis of PELO expression in HeLa.

Western Blot: PELO Antibody [H00053918-B01P] - Analysis of PELO expression in transfected 293T cell line by PELO polyclonal antibody. Lane 1: PELO transfected lysate(42.35 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PELO Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PELO Antibody - Azide and BSA Free (H00053918-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PELO (AAH05889.1, 1 a.a. - 385 a.a.) full-length human protein. MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
• Specificity: Reacts with pelota homolog (Drosophila).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PELO
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PELO Antibody - Azide and BSA Free

• EC 3.1
• pelota (Drosophila) homolog
• pelota homolog (Drosophila)
• PRO1770
• protein pelota homolog

Background

This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PELO
• Entrez:
  • 53918(Human)
• Uniprot:
  • AAH05889.1(Human)