Pellino 2 Antibody - BSA Free

Western Blot: Pellino 2 Antibody [NBP2-88033] - Host: Rabbit. Target Name: PELI2. Sample Type: THP-1 Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Pellino 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Pellino 2 Antibody - BSA Free (NBP2-88033) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human Pellino 2. Peptide sequence: STISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PELI2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Pellino 2 Antibody - BSA Free

• PELI2
• pellino (Drosophila) homolog 2
• pellino homolog 2 (Drosophila)
• pellino-2
• protein pellino homolog 2

Background

Scaffold protein which probably links Toll-like receptors (TLRs) to basic cellular processes via itsinteraction with the complex containing IRAK kinases and TRAF6. Can activate the MAP (mitogen activated protein)kinase pathway leading to activation of ELK1. Not required for NF-kappa-B activation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PELI2