Pea3 Antibody (3G9-1B9)

Images

 
Western Blot: Pea3 Antibody (3G9-1B9) [H00002118-M01] - Analysis of ETV4 expression in transfected 293T cell line by ETV4 monoclonal antibody (M01), clone 3G9-1B9.Lane 1: ETV4 transfected lysate(54 KDa).Lane 2: ...read more
Sandwich ELISA: Pea3 Antibody (3G9-1B9) [H00002118-M01] - Detection limit for recombinant GST tagged ETV4 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3G9-1B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pea3 Antibody (3G9-1B9) Summary

Immunogen
ETV4 (AAH07242, 1 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
Specificity
ETV4 - ets variant gene 4 (E1A enhancer binding protein, E1AF)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ETV4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using H00002118-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pea3 Antibody (3G9-1B9)

  • Adenovirus E1A enhancer-binding protein
  • E1A-FE1A enhancer binding protein
  • E1AFETS translocation variant 4
  • ets variant 4
  • ets variant gene 4 (E1A enhancer binding protein, E1AF)
  • ets variant gene 4 (E1A enhancer-binding protein, E1AF)
  • EWS protein/E1A enhancer binding protein chimera
  • PEA3
  • PEAS3
  • Polyomavirus enhancer activator 3 homolog
  • polyomavirus enhancer activator-3
  • Protein PEA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-10480
Species: Hu
Applications: IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002119-M02
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
1129-ER
Species: Hu
Applications: BA
1310-SE
Species: Hu
Applications: EnzAct
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DMP700
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-16389
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
294-HG/CF
Species: Hu
Applications: BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
212-GD/CF
Species: Hu
Applications: Bind, BA

Publications for Pea3 Antibody (H00002118-M01)(5)

Reviews for Pea3 Antibody (H00002118-M01) (0)

There are no reviews for Pea3 Antibody (H00002118-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pea3 Antibody (H00002118-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pea3 Products

Bioinformatics Tool for Pea3 Antibody (H00002118-M01)

Discover related pathways, diseases and genes to Pea3 Antibody (H00002118-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pea3 Antibody (H00002118-M01)

Discover more about diseases related to Pea3 Antibody (H00002118-M01).
 

Pathways for Pea3 Antibody (H00002118-M01)

View related products by pathway.

PTMs for Pea3 Antibody (H00002118-M01)

Learn more about PTMs related to Pea3 Antibody (H00002118-M01).
 

Research Areas for Pea3 Antibody (H00002118-M01)

Find related products by research area.

Blogs on Pea3

There are no specific blogs for Pea3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pea3 Antibody (3G9-1B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV4
Entrez
OMIM