PDK3 Antibody (2B11) - Azide and BSA Free

Western Blot: PDK3 Antibody (2B11) [H00005165-M01] - Analysis of PDK3 expression in transfected 293T cell line by PDK3 monoclonal antibody (M01), clone 2B11.Lane 1: PDK3 transfected lysate(46.9 KDa).Lane 2: Non-transfected lysate.

Western Blot: PDK3 Antibody (2B11) [H00005165-M01] - PDK3 monoclonal antibody (M01), clone 2B11 Analysis of PDK3 expression in MCF-7.

ELISA: PDK3 Antibody (2B11) [H00005165-M01] - Detection limit for recombinant GST tagged PDK3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 2B11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDK3 Antibody (2B11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PDK3 (AAH15948, 174 a.a. ~ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
• Specificity: PDK3 - pyruvate dehydrogenase kinase, isozyme 3
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDK3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22429297). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK3 Antibody (2B11) - Azide and BSA Free

• EC 2.7.11.2
• PDHK3
• PDK3
• Pyruvate dehydrogenase kinase isoform 3
• pyruvate dehydrogenase kinase, isoenzyme 3
• pyruvate dehydrogenase kinase, isozyme 3
• pyruvate dehydrogenase, lipoamide, kinase isozyme 3, mitochondrial

Background

PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDK3 Antibody (H00005165-M01)(6)

Publications using H00005165-M01

• Ren L, Zhang W, Zhang J et al. Influenza A Virus (H1N1) Infection Induces Glycolysis to Facilitate Viral Replication Virologica Sinica 2021-09-14 [PMID: 34519916] (WB, Mouse, Human)
• Na YR, Jung D, Song J et al. Pyruvate dehydrogenase kinase is a negative regulator of interleukin-10 production in macrophages J Mol Cell Biol 2020-01-03 [PMID: 31900478]
• Hwang B, Wu P, Harris RA. Additive effects of clofibric acid and pyruvate dehydrogenase kinase isoenzyme 4 (PDK4) deficiency on hepatic steatosis in mice fed a high saturated fat diet. FEBS J. 2012-05-01 [PMID: 22429297] (WB, Mouse)
• Acin-Perez R, Hoyos B, Zhao F et al. Control of oxidative phosphorylation by vitamin A illuminates a fundamental role in mitochondrial energy homoeostasis. FASEB J :fj.09-142281. 2009-01-01 [PMID: 19812372]
• Lu C-W, Lin S-C, Chen K-F et al. Induction of Pyruvate Dehydrogenase Kinase-3 by Hypoxia-inducible Factor-1 Promotes Metabolic Switch Drug Resistance. J Biol Chem;283(42):28106-28114. 2008-01-01 [PMID: 18718909]
• 1 Jeoung NH, Harris RA. Pyruvate Dehydrogenase Kinase 4 (PDK4) Deficiency Lowers Blood Glucose Improves Glucose Tolerance in Diet-Induced Obese Mice. Am J Physiol Endocrinol Metab;295(1):E46-54. 2008-07-01 [PMID: 18430968]

Bioinformatics

• Gene Symbol: PDK3
• Entrez:
  • 5165(Human)
• OMIM:
  • 602526(Human)
• Uniprot:
  • AAH15948(Human)