PDK3 Antibody (1G11)

Images

 
Western Blot: PDK3 Antibody (1G11) [H00005165-M03] - Analysis of PDK3 expression in HepG2 (Cat # L019V1).
Sandwich ELISA: PDK3 Antibody (1G11) [H00005165-M03] - Detection limit for recombinant GST tagged PDK3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDK3 Antibody (1G11) Summary

Immunogen
PDK3 (AAH15948 174 a.a. - 263 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
Specificity
PDK3 (1G11)
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PDK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK3 Antibody (1G11)

  • EC 2.7.11.2
  • Pyruvate dehydrogenase kinase isoform 3
  • pyruvate dehydrogenase kinase, isoenzyme 3
  • pyruvate dehydrogenase kinase, isozyme 3
  • pyruvate dehydrogenase, lipoamide, kinase isozyme 3, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82912
Species: Hu
Applications: WB, IHC, IHC-P
NB600-637
Species: Hu, Mu, Rt, Ge
Applications: WB, ELISA, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-83443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP

Publications for PDK3 Antibody (H00005165-M03) (0)

There are no publications for PDK3 Antibody (H00005165-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK3 Antibody (H00005165-M03) (0)

There are no reviews for PDK3 Antibody (H00005165-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDK3 Antibody (H00005165-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDK3 Products

Bioinformatics Tool for PDK3 Antibody (H00005165-M03)

Discover related pathways, diseases and genes to PDK3 Antibody (H00005165-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK3 Antibody (H00005165-M03)

Discover more about diseases related to PDK3 Antibody (H00005165-M03).
 

Pathways for PDK3 Antibody (H00005165-M03)

View related products by pathway.

PTMs for PDK3 Antibody (H00005165-M03)

Learn more about PTMs related to PDK3 Antibody (H00005165-M03).
 

Research Areas for PDK3 Antibody (H00005165-M03)

Find related products by research area.

Blogs on PDK3

There are no specific blogs for PDK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDK3 Antibody (1G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDK3
Entrez
OMIM
Uniprot